PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00018.1.g00310.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 312aa    MW: 34170 Da    PI: 10.056
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00018.1.g00310.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.22.8e-25174223251
                                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                                   rie+k+ rqv fskRr+g++KKA+EL  LCdaeva+++fs+ gklyey+s
  Zpz_sc00018.1.g00310.1.am.mk 174 RIEDKTSRQVRFSKRRAGLFKKAFELALLCDAEVALLVFSPGGKLYEYAS 223
                                   8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.427165225IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-32165224IPR002100Transcription factor, MADS-box
CDDcd002657.01E-34166226No hitNo description
SuperFamilySSF554559.55E-25167225IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-26167187IPR002100Transcription factor, MADS-box
PfamPF003191.0E-24174221IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-26187202IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-26202223IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MSASLSEHVT TDLRTSSDSE IFTRPATASV GAGVVSMDRA VLGGSSSPPS VCRPAVHVLR  60
RTSDLPYTYY DARAACLRRV QLLRFLRFAS CRSAEEASEL VDQKEEPLDS WSGAKINCTR  120
ERRFIGGLEV GPRSAVTLVS SSSPRPHHPR RRGSHAATHP GEAMARRGPV ELRRIEDKTS  180
RQVRFSKRRA GLFKKAFELA LLCDAEVALL VFSPGGKLYE YASTRFAPSP LPPPPSRLAA  240
TAAADQPPCA CAPCARDYPK YMRVVFPAPL AFPWSGAERL FRLATSTCLN TCDVLYVSST  300
DKGGIWRERA RS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-15167224259MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-15167224259MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-15167224259MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-15167224259MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A2e-15167224259Myocyte-specific enhancer factor 2A
3kov_B2e-15167224259Myocyte-specific enhancer factor 2A
3kov_I2e-15167224259Myocyte-specific enhancer factor 2A
3kov_J2e-15167224259Myocyte-specific enhancer factor 2A
3mu6_A1e-15167224259Myocyte-specific enhancer factor 2A
3mu6_B1e-15167224259Myocyte-specific enhancer factor 2A
3mu6_C1e-15167224259Myocyte-specific enhancer factor 2A
3mu6_D1e-15167224259Myocyte-specific enhancer factor 2A
3p57_A2e-15167224259Myocyte-specific enhancer factor 2A
3p57_B2e-15167224259Myocyte-specific enhancer factor 2A
3p57_C2e-15167224259Myocyte-specific enhancer factor 2A
3p57_D2e-15167224259Myocyte-specific enhancer factor 2A
3p57_I2e-15167224259Myocyte-specific enhancer factor 2A
3p57_J2e-15167224259Myocyte-specific enhancer factor 2A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1848192e-66KF184819.1 Saccharum hybrid cultivar R570 clone BAC 004J16 complete sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4396733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-23AGAMOUS-like 20